DPCstruct | MC26
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 6.92 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6KH98 | 5-82 | KVAALILALVRRPGLWPVVARQAHRLAARGWWRRAPFLPLPDAAYMGFRALTQHGDADREPDVADVLVWLVWCREMER |
| A0A6J7N837 | 9-86 | RARSVFALLAHPSLWLTGIRTMGRAQVKGWWYHPPFIPRFEPNYIEFRLATQYGDDGIPEPKDLVTYLHWCRDMDRIR |
| A0A3C1JGU1 | 11-96 | None |
| A0A7V5EXI9 | 4-79 | None |
| A0A6I2YHJ8 | 4-79 | None |
| A0A537ZIU4 | 13-92 | None |
| A0A6B0ZQJ0 | 2-67 | None |
| A0A6I2WEQ6 | 2-84 | None |
| A0A2E4I1S9 | 21-99 | None |
| A0A381ZNJ8 | 2-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.