DPCstruct | MC25997
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444ZFA1 | 78-185 | LNSEAFHSVNSELRELPAVELSTLPLILKTLVESGIADQLRLAELILSDQDFFRKLMELFRRCEDLENIDGLHMIFKIVKGIILLNS… |
| Q75M04 | 3-110 | DESLSSTSRELKKLPPLDLSSLSSILKTILECSMTERMRVSVAELILQYHDFFPQLVNLFRTCESSGNMDALHMIFRLVKGIILLNS… |
| A0A444ZF35 | 78-185 | None |
| A0A835V3E5 | 9-127 | None |
| A0A819R9H4 | 41-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.