DPCstruct | MC25994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 507 ± 46 aa |
| Standard deviation of domain lengths | 46.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4R206 | 62-589 | QSAQTEELRQTMDRIKESFGEYAISPKGDLNESFHETPLGKQYLELRSRAGEPVDLEELKAEIFNHVYTFFSRYYDNGDFLSRRRYS… |
| A0A2A6XVE1 | 4-469 | NEAQFYEVLENLFIGVKIEDQQENLLNPNAKAVKNGMINLMKAKSKYYQSKKQELKKLIDSKCQDNNDLKEELFDKLYSFFKRYFSA… |
| A0A7K4B0T0 | 24-510 | None |
| A0A8B5EBE9 | 1-465 | None |
| A0A5B9D7Q7 | 2-490 | None |
| A0A651GWN2 | 6-468 | None |
| A0A7Y8DQN9 | 4-573 | None |
| A0A3M1AQ10 | 1-473 | None |
| A0A376LH36 | 1-561 | None |
| A0A7V5NBB3 | 1-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.