DPCstruct | MC25992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2P483 | 1-79 | MAPRDFCRICFGIDGLPPEEIAEFETESGYRKRCVKLLARVIGVTERAVRTWGKGLNFEKMPECHKKTLAYALKALQTS |
| A0A355DWR7 | 1-93 | MSLQQTFPQFLDARSFCRLWHGLDKLDEQALQKQERVRGYRAKCVRLLAFALNLQLDTVERWGEGVEFERMPIKHQATLALRWQIKT… |
| A0A433VK67 | 16-89 | None |
| K9F3Y2 | 5-88 | None |
| A0A563W4F1 | 28-126 | None |
| A0A846D4A7 | 51-148 | None |
| A0A1T4ZHR0 | 36-111 | None |
| A0A6B3ND73 | 10-98 | None |
| A0A846FPP3 | 1-76 | None |
| A0A2Z6CNZ3 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.