DPCstruct | MC2599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 90 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P9TJ41 | 68-151 | DVEAFPQTTLSIVPQEPIEVDVSASGRIETESSALDKPNKRTVQGTIRNRTIFSYAGELTHFDINGRAEVQKNGHSVDPSEVLP |
| A0A365TF85 | 237-322 | SSQPATRAVTLDGRSTNGWTHYELSASSGIEKSKAMNASIESDDVVSGATAEGWVGPWKDSYVVEGDITNFSAPDSLRVYVDGETV |
| A0A6B0GMV0 | 445-527 | None |
| A0A3P3RKR7 | 106-211 | None |
| A0A3P3RKH2 | 439-520 | None |
| A0A1N7FJJ7 | 54-137 | None |
| J3EU64 | 192-281 | None |
| M0MF00 | 127-233 | None |
| M0MI34 | 1-92 | None |
| M0MA59 | 3-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.