DPCstruct | MC25985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 248 ± 18 aa |
| Standard deviation of domain lengths | 17.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 67.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 32.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A9AQ03 | 2-240 | ELLNEYKNDEWELNKNDFLQICLEEFVREQNKIYSNSENTNLVMKNISIQNTKEDKMVLLDKWSERCRPLWEKFKSENAFKVLQYEW… |
| A0A024X4P2 | 12-253 | VIEIHMELLDESKREDWELNRKQFLEICIEQFSYILETEKKNIIKLNKLQLNIDNEDIMNHMTEKQHMFIQKMMERNKFLLEMWKRK… |
| A0A1A8XCH4 | 9-256 | None |
| A0A1J1GZ12 | 216-454 | None |
| A0A1D3JFH8 | 567-819 | None |
| A0A1A9AI26 | 2-280 | None |
| A0A1A9AHH6 | 209-453 | None |
| A0A1J1GKU0 | 14-273 | None |
| A0A1B1DSM9 | 559-777 | None |
| A0A1A9ASR4 | 149-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.