DPCstruct | MC25984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 197 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q8DTI6 | 36-235 | PAKNATDFDQAVDTLGDALCSYSVRGWHCTRLTDDEAADVEVNGMTPLSADLIERRIAAQVQRDTLPVAVGDALRSAHQGSAHNRAG… |
| A0A7U9NAN3 | 78-250 | ITCQNADDFRQQFQFLRAYHGCRPLRISDYTENGLQILNKKRLFRLTHELLGKYVEEKELNNIIETRWDRYPAKGIYFALDKNELLN… |
| B1YXU3 | 15-212 | None |
| A0A7T4SLT4 | 11-221 | None |
| A0A120FW00 | 9-211 | None |
| A0A7V3N006 | 4-189 | None |
| A0A212DL14 | 2-159 | None |
| A0A3D8GXW7 | 11-224 | None |
| A0A1H9XGN5 | 86-302 | None |
| A0A6N9PX84 | 20-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.