DPCstruct | MC25982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 144 ± 13 aa |
| Standard deviation of domain lengths | 12.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6V711 | 1-130 | MKYVEVDMIGTVIVVKQINFRDSICKPCQVLYDNGYIDTTKPMILGNVLGSVMFSNYIPEEEVGEIIMRLRQYYDVHYTEATYYVDK… |
| A0A3D2MCT5 | 1-146 | MKQKADYVKSNNLWKKLTKEQKQYLINKYIDEIEIDYDKNYNVSIRNILFNKNEIENIAYMFRSDCFDMIVNTHERDIILSNYTKEK… |
| A0A7X6NX78 | 187-332 | None |
| R7F5W2 | 159-275 | None |
| A0A1H6Y9F8 | 83-219 | None |
| A0A1Q6LGQ3 | 272-409 | None |
| A0A352MWE9 | 157-308 | None |
| A0A3D2MJ12 | 279-439 | None |
| R7KDJ1 | 108-257 | None |
| R7M9L3 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.