DPCstruct | MC2598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 157 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19741 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A553ZQZ9 | 299-434 | VPEGPWHLEASSLTLKELDYKGVVNLRTPSGRTKQALKFTAGGIDIGDLHQIVDGPNGLKYHVRSTPGSTSTIRDGQVTLYTERLQG… |
| A0A365T575 | 5-199 | FAILAIVVMVIISSGTAYALPVAGVGGFTIKADKITASDQMLYPGVEDTSEQKAYPVAVVEQKNTRIVNMVLIKQLPVDEVPLLNGN… |
| A0A3N0CQ97 | 45-250 | None |
| A0A381KJL5 | 249-431 | None |
| A0A5C8MR30 | 6-165 | None |
| A0A429FRS0 | 177-312 | None |
| A0A2N3Z6B7 | 226-366 | None |
| A0A561RHG8 | 5-133 | None |
| A0A523AZL5 | 19-138 | None |
| A0A7H8LKA5 | 6-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.