DPCstruct | MC25977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 20.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.65 |
| Pfam Score | 94.49 |
| Assigned Pfam label(s) | CL0020- CL0381 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G5HYL0 | 154-302 | MHDQALNLANQGVTINEIHNQFTVPESLSNEWFNRGYHGSVSHNVRGIINKYLGFFDMNPATLNKLSPADSAKRYVKLAGGSKAMLN… |
| A0A2D6BNH6 | 59-183 | FVIGDETAALVKLPPHLAAEPTLRDHYHRLSWIVKGLYTRFAGWFGDDALEMIQHTPAAEAERMLALAGGAERVLQRGRAALAEGDA… |
| A0A379XVR2 | 102-301 | None |
| A0A4U9CYM5 | 1-138 | None |
| A0A1C3JIQ1 | 123-306 | None |
| A0A7W0IYZ0 | 19-165 | None |
| A0P017 | 195-358 | None |
| A0A7W6E1I8 | 88-226 | None |
| A0A370I2G5 | 53-196 | None |
| A0A2D8IVC2 | 397-557 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.