DPCstruct | MC25976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 7.08 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E5VKY9 | 1-86 | MLRNVLSAVVPACPALVHVCLQTGTKHYVGSFEAIGKIPIPLDPPYTEDMARLDCPNFYYDQEDILVDAVARRGGAVSWSVHRPRL |
| A0A2D5SWW2 | 1-78 | MLRNFIGALPLAGLKPKRFLLQTGAKNYGVHLGMGLNPAVESDPRVEIEPNFYYPQEDMLWEYCGREGVGWNVIRPAW |
| A0A369Q153 | 1-68 | None |
| A0A1J9R0T6 | 108-195 | None |
| A0A4V5ND57 | 100-187 | None |
| A0A370TBS5 | 78-167 | None |
| A0A6A2WUM6 | 96-178 | None |
| A0A498HMU9 | 122-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.