DPCstruct | MC25975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 105 ± 15 aa |
| Standard deviation of domain lengths | 14.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J7I546 | 5-84 | DIRTLFLDVDRFFKSYSRYCDFDRISSDLRVAEKESNTIVEKWPMRLIHQPGQEGAQEEFKVMLRSNFTGMERYLEWKKV |
| A0A2D5SWA2 | 31-119 | HPADKTSGAFIQMVEARTIFCDFDDLFEKYMKEVGFDVAARMAGVVMKRKNTIVGEWPLRLRGGARTEEFDLLLASGHTGCERYVEW… |
| C4JQL0 | 412-494 | None |
| F0XDS6 | 656-761 | None |
| A0A423X0F2 | 308-416 | None |
| A0A395HXZ3 | 256-357 | None |
| A0A1S8A9N7 | 4-103 | None |
| A0A0F4GLC9 | 580-679 | None |
| A0A2L2TDE3 | 52-148 | None |
| A0A6A5ZV30 | 80-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.