DPCstruct | MC25972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 155 ± 21 aa |
| Standard deviation of domain lengths | 20.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816MQV4 | 4-145 | SILVGNVGIQLFLSLLQPPAPIWISSLPPGHKIRPAGYYIMEDIVAVDGDGGSAYRRALNQRYESSPIFQCLVYEMTMFWAIGGLVF… |
| A0A2D5SRL2 | 34-179 | PVLMYFLATLTALSILLNALGTTLPFRFGSMDSGIVVRPAIYYIVEDVVAVDGNGGIEYREAFSARYESSPMFRSMITTLSVVWCLA… |
| A0A5C3LZ93 | 81-232 | None |
| A0A7D8ZA87 | 93-239 | None |
| A0A179HPY5 | 321-504 | None |
| A0A1L9UES0 | 113-298 | None |
| A0A1V6T5R5 | 5-152 | None |
| A0A5C6SUW0 | 38-195 | None |
| A0A5N5WPS5 | 4-121 | None |
| A0A0D2HE88 | 318-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.