DPCstruct | MC2597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A482YCZ7 | 8-161 | MFSVDSDDSRRSFLKKGAIASSALAIGASGTAMAQDDDILDEEWKALIHISNFYPDARFTFVSGVVEWVPNYGDVNDSWFSDYNTYQ… |
| A0A365T4Q3 | 1-137 | MMAFNKNQIDTASLSLQDGNAREGYMFNNQFQPGSQFVVISEALPWNPENVGEGQLFTSFQTRMIQYTSAPNQFAFLFPYEDAQVQQ… |
| A0A6G3ZI83 | 15-173 | None |
| A0A7D5P3U4 | 28-170 | None |
| M0LU25 | 45-170 | None |
| A0A0W1R936 | 8-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.