DPCstruct | MC25965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 3 aa |
| Standard deviation of domain lengths | 3.10 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 44.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0061 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9V425 | 83-183 | MAFIRDTFSVKTCIGVTKLLKDCTAWELLNLNVSTVLDLPDRLHSEYSISPEFLDKVMSKYIIQSINKDTLMQRWGLTQQPVVLSPS… |
| A0A2D5SLN6 | 1-106 | MADSFLIDTCVGERKLFTEVTFWELSNLKPKDILDIPDRFAREYGVSPKYMEKVLLEYSIQQTGKDVLEREFDLKPPQYFLSNTRHY… |
| A0A1S8A7L7 | 95-193 | None |
| A0A0C9UEB4 | 1-106 | None |
| A0A1J9RPZ9 | 200-293 | None |
| A0A2I2GMI9 | 195-294 | None |
| A0A4S8KL41 | 194-294 | None |
| A0A0K6G9Z7 | 244-344 | None |
| A0A0K6G3W4 | 61-161 | None |
| F8P8Y2 | 96-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.