DPCstruct | MC25964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 4 aa |
| Standard deviation of domain lengths | 4.41 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9VUJ5 | 12-105 | QEIQLSVPAAAEIPVAISLYDLLHNSLILRHVAPYLPIASLLHLAAASRYFRHLILQTPGVFRHLDLSRVQSLQPEYRRIRPDDSIT… |
| A0A2D5SL50 | 1-93 | MEDARKTPSKSTSLPTTLLQLLSNTLVLSQTTPYLPPSSLLALGSTCKAFQILIRDTPVVFRHLDLTKVKSAQFEIAAIDHGGEVWR… |
| A0A232M0U7 | 89-175 | None |
| A0A395ISG0 | 1-97 | None |
| A0A4V5NI53 | 1-90 | None |
| A0A0F4YWP9 | 83-179 | None |
| A0A517LII3 | 23-115 | None |
| A0A6A6WF77 | 1-101 | None |
| A0A2J8CK29 | 11-97 | None |
| B8MA43 | 77-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.