DPCstruct | MC25961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 231 ± 66 aa |
| Standard deviation of domain lengths | 65.61 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 67.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.14 |
| Pfam Score | 44.44 |
| Assigned Pfam label(s) | CL0114- PF08766- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151JYY2 | 1-123 | MEKLGQIPEVVAKIKTASRPIIQTLHKFIFEKEGDRKSRQNLRDFPGFSFTEDSMEFRKKMEFAGAFSIGDLTTICNMLGLEYIGTK… |
| A0A1A6H5C2 | 11-212 | FTIEQGKGQKLCEIERIHFFLSKKKTDELRNLHKLLYNRPGTVSSLKKNVGQFSGFPFEKGSTQYKKKEEMLKKFRNAMLKSICEVL… |
| A0A368G3I3 | 10-281 | None |
| A0A0N0P2C3 | 8-247 | None |
| A0A5N5TL32 | 61-313 | None |
| A0A1S8VUV5 | 159-395 | None |
| M1UT73 | 38-290 | None |
| A0A158QTW3 | 486-650 | None |
| A0A5J4YTH4 | 2-313 | None |
| D3BDK9 | 132-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.