DPCstruct | MC2596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 15 aa |
| Standard deviation of domain lengths | 14.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495V2G5 | 125-288 | GQIRTTQGRLYTALWKGDLAVLREEYDHPDPPMPIRLVTKRLARTHAVAAAIAREFGSAEASAEEASAPHPPVFVMVQDAANAVSRE… |
| A0A831NEB1 | 1-152 | MLWKGDLEILHNDTPEPQPPLFIQNAKYFLKEFEFIFKDRIKNQNVKFVMPYDSTNDLAKEKDFKIKSALKKEFNFETIEMSPEEAE… |
| A0A1G0RRW4 | 84-253 | None |
| A0A7C1MQM2 | 119-308 | None |
| A0A1W9KWV2 | 70-222 | None |
| A0A838SFQ5 | 8-205 | None |
| A0A831UJT6 | 57-222 | None |
| A0A2A2Y0K4 | 1-171 | None |
| A0A812JJU0 | 335-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.