DPCstruct | MC2595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 267 ± 53 aa |
| Standard deviation of domain lengths | 52.86 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N9C4N5 | 195-400 | ILKKNNKSAYISNLSGLSTYPTLISNEYNSLDILSTTAHEWLHLYWFFKPFGKNIFKSNEMRTLNETAADIAGRELGLQTYMRLNSN… |
| A0A831JDX2 | 33-329 | QLMHQRQNIREVLEEGTVSFEQKKKLQLVLEVRRYALETLKLEGEQNYIKYVHLERDSVAYNLVVCPKDRLEPYRWWFPFVGSVEYL… |
| A0A534U3X8 | 190-496 | None |
| A0A7J6PVY6 | 84-376 | None |
| A0A2E0Y5C3 | 53-367 | None |
| A0A4D7JZ29 | 11-263 | None |
| A0A7C7MDD7 | 4-207 | None |
| A0A2E0D361 | 68-305 | None |
| A0A7J4QG28 | 48-342 | None |
| A0A848QA52 | 8-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.