DPCstruct | MC25947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03752 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365UWV1 | 1-119 | MPVLVLTTLSVPHPAQAEDVLPEGMRELRAQVLDSVLLGGPATSAAARKALLGTDADVQHFLSTELPAVTSIDTRLRVLQMLSAGGP… |
| A0A3L8KX97 | 72-183 | GSSARSAQSSVVKAVGQQGEEPAGQDQQAERDRNEILRVISFGGPGVKDAGKAALGGTPADMRKFLETGQFVARDDDNMVLISRIIY… |
| A0A445N7L5 | 1-133 | None |
| A0A4P6TZQ6 | 2-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.