DPCstruct | MC25939
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 258 ± 24 aa |
| Standard deviation of domain lengths | 24.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K1I2T1 | 146-391 | SAEDIARARRRLGAIDERLLEAAHEPFAARALVYGILMGADPFSREAQRQALEGQALPEVLRELEALDASLSGLAPGQRLPLIELAL… |
| A0A6J5H2Z8 | 2-232 | PDLLRLAAQEPFSARSLVYALLVNPLEDLRELQLIQLKASAEPQDFAETLRLVCPVQALPDTHRLPLLELTMPALRQMSLRQHRVFR… |
| A0A0T6UM48 | 380-628 | None |
| A0A2T2TGY0 | 43-330 | None |
| A0A3D5JXL4 | 143-430 | None |
| A0A534NP21 | 16-288 | None |
| A0A7V4M0Q3 | 160-413 | None |
| A0A853IDJ9 | 269-549 | None |
| A0A521HFJ1 | 204-467 | None |
| A0A2V6F9C5 | 1-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.