DPCstruct | MC25938
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 116 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A509J751 | 147-267 | TIESASAKVRRNKPANAIDTCWDNSGKRIAEKAVFSGPTQCNALYPAHKNPRLAAGMPLKHDVLKCQLKPVDVSDYAQAMTPAQVAR… |
| A0A2V8TD11 | 90-204 | SPLSTEKVVRNKAAEAVDAYWDVSGKKFVETATFDGTGGFNKMYPVHSEPRLVAGAPLTNDVLKCQLKPIIYADYRVTFNGAQKLRL… |
| A0A7V9VP41 | 26-133 | None |
| A0A4R5AH78 | 860-969 | None |
| A0A534WF74 | 1-124 | None |
| A0A2V8CFV6 | 108-227 | None |
| A0A318EG82 | 96-223 | None |
| A0A7X7NMC1 | 53-156 | None |
| A0A1Q3NHH4 | 398-512 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.