DPCstruct | MC25934
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 126 ± 7 aa |
| Standard deviation of domain lengths | 7.15 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7T4W5 | 1-117 | MRSLLAALHLYPTEAALDVKVEPWKLTLSYPNATSESVFTFVVGTFTKKPTVSGWEDVQGLKVTVSGNVDEDYELSFAGANGGDSSP… |
| A0A2W1GQM5 | 637-765 | FNPAVVQWSRKDGTVGWMSLYAQVYALDVVVGEGSLELSYPQGNETSAFSFLVGTNGWGGKRDVGGWADVEGVRVNVSGSVDLEYGV… |
| A0A135V2A5 | 375-502 | None |
| Q0U2D8 | 154-283 | None |
| A0A6A6BJF6 | 222-331 | None |
| H1VWR7 | 87-212 | None |
| A0A395IJB1 | 307-433 | None |
| A0A5N6WPF0 | 564-685 | None |
| X0GP85 | 131-255 | None |
| W6Q055 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.