DPCstruct | MC25933
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 13.05 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1V3S5 | 190-303 | MKTKRMEAYICRTFKTVAADGLPIFTCRLASVETSAKPSLTMEKEKYKNAYFQITRGDYSPLLKKVNENLTKAIDYAANDNEKNMLR… |
| M7T154 | 34-153 | YYPKNDVNESDIAMVSKILEQNSIYPENTRLWKAENGVDFEVLLASVETGEITKLPLPNEKGSVSIIPGDHSSDLRHVCAELVEASK… |
| A0A0F8V2X4 | 89-221 | None |
| E2LCU7 | 96-218 | None |
| A0A7G2CTP2 | 207-316 | None |
| A0A2G5IB72 | 1-101 | None |
| A0A4Y2LPP4 | 64-172 | None |
| A0A1X7T4G1 | 1-132 | None |
| A0A1X7T434 | 214-336 | None |
| A0A168B720 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.