DPCstruct | MC2593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 192 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4X6F0 | 127-309 | YSELNHQIAGVFVFLAGGFALLAASGNPRFAWTQYSWPLFFFLMGLFLFVRHDPESWPWGPLPLLEAIRDPQVLQHSLFTVIVLGIG… |
| A0A532EFQ7 | 1-182 | MAGVFLLLIGLSEVRQALGWPALVWTRFLLPGALTVGGIFLLIWSDHDSWPIGSMTFAQTFFGSDEEVLQHKTYGVLAFAVGVIEFL… |
| A0A356R874 | 2-165 | None |
| A0A2W0BXR2 | 300-490 | None |
| A0A1G2VIT0 | 224-417 | None |
| A0A3S0EEJ2 | 5-199 | None |
| A0A2V9ZI48 | 33-230 | None |
| A0A7V1RCW0 | 172-358 | None |
| A0A2V9YS55 | 32-212 | None |
| A0A2V9AXA8 | 41-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.