DPCstruct | MC25927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 178 ± 19 aa |
| Standard deviation of domain lengths | 18.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0B636 | 197-381 | MQAALKLQSHSLGGLPTYESIQKTPSASLLQAFQRAKAVAVGEAKTTVMAVSLTDVHIFTLAKRGGAEQYFSFAHVFTLGVGPEGVM… |
| M7SLU3 | 11-157 | ASTSHKAKEAALKDGKTTVLSVTLTDVHIFELAQRGLAEHCLSFAHTFTIGIGPDAVIVWQAWGKHGYSLDEYIRDGHARVRDLEEA… |
| K0RNQ8 | 85-281 | None |
| A0A6A5UUZ6 | 16-162 | None |
| A0A7S2HIQ5 | 133-344 | None |
| A0A7S2MEF9 | 91-288 | None |
| A0A165ZDN9 | 25-206 | None |
| A0A1M3TQ15 | 2-189 | None |
| A0A1L9T8J3 | 144-309 | None |
| A0A6A5TBA0 | 254-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.