DPCstruct | MC25926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 228 ± 55 aa |
| Standard deviation of domain lengths | 54.93 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.60 |
| Pfam Score | 88.33 |
| Assigned Pfam label(s) | PF04652- PF09787- PF18097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397D5Y7 | 4-171 | KIPATFKAVTPFIRRAEELDRDRSRPESQMVAYYCRQYAMELGIKLRNHDASDEASNYLLSLMEALELEMRSLPAHTHEEGRIICEN… |
| M7SGA0 | 5-244 | IPAKIRQAGIVPFVLRASQLDAARPVISYWCRYWAVNQILSKQLHNVDQECLEFTTTLMDRLEQTKNEQAGNEAILDDAAGQVYVEQ… |
| A0A812IQP8 | 209-447 | None |
| R1GXM5 | 1-281 | None |
| A0A433QFB2 | 3-259 | None |
| L1LB59 | 9-220 | None |
| A0A0S7E7X0 | 849-1033 | None |
| A0A2S4VP89 | 2-255 | None |
| A0A177WGA6 | 360-623 | None |
| E9G4D0 | 9-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.