DPCstruct | MC25923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 406 ± 69 aa |
| Standard deviation of domain lengths | 68.91 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2MA72 | 2-368 | WLRLSRFSTKKYVLVGRNMVDFTHYTDIDRMLRVINSLGVDVVGGAVRLEPEGRWYAGCYQSTIRNFTLRIHPGHDQSTQSCAYCDY… |
| A0A6J8C019 | 133-435 | IIAYIRTNTVLFVSDGCRIASLSNFKLMLQKFTFQNRVRAYAIQTGSAKLSCPGIQIDMKRWTVKIEDFTGIEGLCDFIDGDQAILM… |
| A0A7S4QD25 | 433-872 | None |
| A0A812IN62 | 289-761 | None |
| A0A7J7J8L4 | 252-628 | None |
| A0A2I0T0D3 | 1-269 | None |
| A0A7D9LPV1 | 186-550 | None |
| A0A812LUC5 | 429-771 | None |
| A0A813FLU0 | 755-1203 | None |
| T1J192 | 402-801 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.