DPCstruct | MC2592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 118 ± 16 aa |
| Standard deviation of domain lengths | 15.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2KQJ3 | 1-111 | MPCEPEEKLMLAVLEDAIYECIFKCVLSRNRRGKRIFNDAYNWIRATGWDGPFVFEIICETLKLNHHGIRDGVIRWVEDARQRKQRP… |
| A0A7Y4U7F9 | 1-115 | MDTHEEHQDSVSLGDLVPENDNNPIAARVRMSGEFRLMWAVFEDGLDCYLRYADHPSHHMQERFREAKAWIESDEDKWLFSFVNICQ… |
| A0A1F8XYZ7 | 15-122 | None |
| A0A6I1QZ73 | 1-151 | None |
| A0A2V7S586 | 1-93 | None |
| A0A2M8KY50 | 115-224 | None |
| A0A2H5ZK12 | 6-115 | None |
| A0A2V5MDQ2 | 35-196 | None |
| A0A534TYK4 | 3-128 | None |
| A0A534TUE0 | 5-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.