DPCstruct | MC25919
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 93 ± 3 aa |
| Standard deviation of domain lengths | 2.78 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 51.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05794 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9G1D8 | 10-100 | TSSDETIETRKQILTRVFLKSLQTDDNVFKKVSRSVYCAFRAITLGGSGAKARKLADAALRRIGAAKLTDRVVKAAEVLIKATMISE… |
| A5AX61 | 1-88 | MANMLGKSLQAGDAIFTRVSHTVYLAARGIVLGGNGLKGRQLAEAALRRIGASLLTENVVEAAEVLIVVTTVSSSVHGAWYEELVKNL |
| A0A0A0KGG6 | 1093-1187 | None |
| A0A2T8ICG4 | 85-179 | None |
| A0A2U1KJN5 | 643-739 | None |
| A0A444EQK8 | 594-686 | None |
| A0A5P1FH50 | 378-469 | None |
| A0A2G5DBM5 | 761-856 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.