DPCstruct | MC25913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660NAS7 | 1-121 | MQFTSASKYSVPNFVGATVRDNYPLDKTVRLTFDNANKSQLKNFLAAVKKDGTEVSVNGVAYHKVSSFSRGDSNVFKVTQNYGTGKD… |
| A0A417ADG8 | 13-106 | SYEIVVTGEKVEDWLEKVSGVSLNGKKYSVSNSYFDMNQKYRVIPVDRTIYISIADHSNDKNTIVISAAGYDDLIIILDRRGNQVTE… |
| T2RDK7 | 1-94 | None |
| D4MUU6 | 47-164 | None |
| A0A7T3K0N1 | 503-607 | None |
| A0A1Y4LRI1 | 10-107 | None |
| G9WN65 | 279-390 | None |
| C2KUQ6 | 375-493 | None |
| A0A7T3K0G0 | 60-156 | None |
| A0A1Y4EVD7 | 274-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.