DPCstruct | MC25910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 4.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 61.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9E2M2 | 1-56 | MRQSLEKTFDEIYIIDLHGNSKKKEVTPNGLPDKNVFDIQQGVAVCFMIKYPQEKT |
| A0A2H6EGW6 | 81-131 | MRQSLMKSFDEIYILDLHGNSLKKEKAPDGGKDENVFDIQQGVAVVFMIKY |
| A0A2D1ZAB4 | 1-67 | None |
| A0A838L135 | 150-203 | None |
| A0A7W9SJL2 | 1-56 | None |
| A0A7Z0L066 | 59-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.