DPCstruct | MC25906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 111 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1J3M0 | 347-448 | AAALEQNGAIGAYEVMKKFTDGLGGSYQAHHILEKAMARDWQLGKDFGKLPAVILTEAEHKRITNELRALTPTAQDVKALWGYYKRV… |
| R6H6L9 | 80-195 | TAGAAEEVDIASLIGKLGTYNELRAEAAGTGLQVHHLIEKRFMAIEEIKEMFGTSGKMPSVIIDKDTHQMYTNSWRGAFPYGSNYGG… |
| A0A1B9MV32 | 115-213 | None |
| A0A496UPC2 | 28-134 | None |
| A0A4U1IX85 | 246-347 | None |
| A0A350XI74 | 91-203 | None |
| A0A4V2SL83 | 630-765 | None |
| A0A553KDE3 | 43-156 | None |
| A0A1W1Z7I8 | 302-418 | None |
| A0A413R800 | 106-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.