DPCstruct | MC25905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 220 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F6XWL9 | 11-202 | STTVTPGHNYHIHVDPVVAEDSCGVAMSHFNPYMAPLGSPAYATYCSRTNPLACEVGDISKKHMQYDIGSGRKRVVDTDLPLHTDQT… |
| C3YJ06 | 65-318 | VKRGDSRIHESNSCLSNRTNYPELTRQIEQDVQISRIMNRLDIVDGTSTHDVHHGVPKGFNQDQRKEQGNYATRCKPGNPLRCELGD… |
| A0A556TTX2 | 215-447 | None |
| A0A3Q0J153 | 582-812 | None |
| A0A2B4S9E4 | 144-336 | None |
| A0A6J3BV03 | 360-577 | None |
| F6W2U3 | 186-410 | None |
| A0A4Z2B133 | 20-220 | None |
| A0A085MML2 | 608-828 | None |
| A0A0B1PQ49 | 24-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.