DPCstruct | MC25904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 240 ± 21 aa |
| Standard deviation of domain lengths | 21.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4YIS4 | 2-223 | GDVYLDRGTVSRNGSDFTKASALYNSALVRCQDPDNTQALLHRIKRTEKVFLEKVGGVKEAVSSIVEADLTHKSQLQDIRSECDTRL… |
| A0A7D9J3B5 | 1-218 | MEEELDISVTVEQLRSAGTNSSKQVPALLKLGEWYLKKAKTIPNGANFTKANALYNAALVRSRSINHEIGEDQILRRIVETYREFLY… |
| A0A6P4YSB2 | 555-833 | None |
| A0A6P4YD20 | 36-288 | None |
| A0A0C1K134 | 93-317 | None |
| A0A6P4Z955 | 10-253 | None |
| C3YHZ6 | 20-265 | None |
| C3YCN8 | 277-527 | None |
| C3Y4V2 | 286-535 | None |
| A0A6P4Z722 | 319-538 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.