DPCstruct | MC25902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 10 aa |
| Standard deviation of domain lengths | 9.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 40.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4B389 | 3-81 | DLGALSQEQQSKLNKFKIQTRVENEKYLREHPEVESLMGGFLSDVLTKRPDNIQEFAAKYFIQPDVNSVVEKSLEDRQN |
| C3YBA8 | 1-98 | MAEGVAKPQRDPPQGMEPFDRGALSEEQQAKLNQFKVQTRLGNERYLREHPEVSCMVSGFLSDVLAKKPENIREFAAEYFRNPELPD… |
| A0A4W6FUL5 | 1-90 | None |
| A0A5K3F1J7 | 1-83 | None |
| A0A7S2UWC7 | 31-108 | None |
| A0A177AV73 | 8-87 | None |
| W6USW4 | 18-126 | None |
| A0A564YU18 | 13-99 | None |
| A0A504YZ87 | 31-107 | None |
| A0A1J1HDC8 | 80-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.