DPCstruct | MC259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 178 |
|---|---|
| Mean domain length (aa) | 185 ± 41 aa |
| Standard deviation of domain lengths | 41.28 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 29.71 |
| Pfam Score | 98.49 |
| Assigned Pfam label(s) | CL0237- PF19276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3GDE6 | 50-243 | CQVFNDPIHGSIELHPLLIKIIDTPQFQRLRFIKQLGGVYFVYPGASHNRFEHSIGVGYLAGKLAEALRSRQPELNITERDVLCVQI… |
| U2LEI3 | 23-253 | SLPIASYHRILSADFPEFINKYVDLPILQRLSGIGLLCGTDWTPLYRNRFFYSRLDHSIGVALILWHFTHDQAETLAGLLHDVSTPV… |
| A0A397FLL1 | 5-227 | None |
| A0A5M8P8T2 | 6-112 | None |
| A0A378BDN0 | 2-235 | None |
| A0A453DNC3 | 2-204 | None |
| A0A1Q9CGN6 | 26-249 | None |
| G0PHH4 | 6-214 | None |
| A0A1D1Z3E0 | 11-212 | None |
| A0A177WV99 | 2-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.