DPCstruct | MC25899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 50 ± 8 aa |
| Standard deviation of domain lengths | 8.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.80 |
| Pfam Score | 99.00 |
| Assigned Pfam label(s) | PF00057- PF02931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VGE6 | 195-232 | GEQCPLGELRCLGGLCISLDQVCDGLAQCPDGADELNC |
| A0A182EZW2 | 1-50 | MIFIECSEKRSVAENCGAKYYTCDSGDCIPREKACDRHYDCSDGSDEMKC |
| A0A1W0X5A3 | 363-415 | None |
| A0A3B4G0Q4 | 32-82 | None |
| A0A1B0BPK2 | 24-66 | None |
| C3ZFD0 | 79-124 | None |
| A0A7E4VIW5 | 132-196 | None |
| A0A4Y2UT73 | 10-53 | None |
| A0A1W0X9P2 | 611-649 | None |
| A0A482WK41 | 120-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.