DPCstruct | MC25895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 267 ± 39 aa |
| Standard deviation of domain lengths | 39.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 40.22 |
| Pfam Score | 80.95 |
| Assigned Pfam label(s) | CL0020- PF03455 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3Y2D2 | 4-231 | QMFIGFIEECSFVSEKDTSLAFFDECMDKVDPERSDRPVEQLIDLEESFKSEHTVFVTPPEPRDLPDDRKYSYTVFPDLDHSLFLRP… |
| A0A077YZ52 | 571-893 | QQKRKKLELEIQETFLRFMATIMKDYHLYLRPIKSAPSIGSTDLEALFDVNGFLRSRDKGSQDFYRLLINTQLFIRFIEERSFLTDR… |
| B3KXP9 | 67-310 | None |
| A0A3M0IP40 | 253-497 | None |
| A0A6V7XTI3 | 580-932 | None |
| A0A2I4DC49 | 383-628 | None |
| V4CGX7 | 3-227 | None |
| L5JX24 | 54-301 | None |
| A0A1S3PW28 | 445-684 | None |
| A0A0K0E693 | 634-940 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.