DPCstruct | MC25890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 254 ± 16 aa |
| Standard deviation of domain lengths | 15.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 47.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834F732 | 5-224 | EERRQLEEEEEKRQALEKRREEKRLEREREEEKQRRLKRQQELTRLAHQHYDRTLLLRRGLAPWKRLVQFLKVNKELAESHHKLLLL… |
| C3XS06 | 2-264 | EERAALREEKKRQIEERKRRKEEERVLRLQAEEEAKRQAEEEEKRARLERIREEKRLMKQRELEKQERLERQAQQNATADQHYRNSL… |
| A7RTC4 | 358-616 | None |
| A0A6J0WC49 | 482-736 | None |
| A0A6P4Z3W7 | 719-994 | None |
| A0A6J0D9T2 | 525-775 | None |
| A0A7J8HN86 | 115-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.