DPCstruct | MC2589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 207 ± 22 aa |
| Standard deviation of domain lengths | 22.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W0WFJ3 | 113-342 | TDQYHCYVPTQHNVTSDTFITAMHTHHPFSWIHRIPQDNLVPFKCCKTPLGYYIDYVSCYYQPTHDPNFEYYDSPFQFIVYCAQGHV… |
| A0A1D1V517 | 1-200 | MTDQYFCYDQHRHSQTSNTFMTGIWARTSNFYIYQTNGTVLGDPFGLNDDFQPIKCCKTPTGYYIDYVSCYYMPTHDMYWEYYDAQS… |
| A0A1W0WDT6 | 108-310 | None |
| A0A1W0X0K1 | 482-671 | None |
| A0A1D1UJT3 | 24-192 | None |
| A0A1D1UXZ6 | 125-303 | None |
| A0A1D1V006 | 45-260 | None |
| A0A1D1V0S0 | 1-245 | None |
| A0A1D1VSI7 | 2-226 | None |
| A0A1W0XFA7 | 88-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.