DPCstruct | MC25886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 106 ± 5 aa |
| Standard deviation of domain lengths | 4.98 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 21.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G8EVN0 | 1-107 | MIRPWGMFCISLINTLIIVSPLFTSVTVGNKGDLEHAAFGWPFPFVMQDLSMYDPPYPYNMTFATPWETPTSIHPFFFIASFVVVNA… |
| K9XCK6 | 1-103 | MRQPVTSVAIILSIILVFVSVYLPTTVLSQAELAGVKFGLPFSFIVQSQAYHPPFFPWQTSISSIWEHPIQIYFHVFFIDVVIVCLG… |
| A0A0D0HYD8 | 1-111 | None |
| A0A0A5I4K0 | 9-116 | None |
| A0A1R4I038 | 2-100 | None |
| A0A3N0DWA5 | 17-113 | None |
| A0A653A6B0 | 2-110 | None |
| A0A0G4AU15 | 31-133 | None |
| A0A2G8CXJ9 | 23-134 | None |
| A0A4R6S474 | 18-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.