DPCstruct | MC25885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847BZG2 | 20-108 | SLSEAEVKRRVMADLKTVMGITEEPDFVRIYPHPRAIPQYRTGHAARLAALEERAAACPGFFFTGNAFFGVGINDCVRASKEVAERV… |
| A0A662CGC3 | 2-86 | EMVRKDLAIIMSISAPPLLVQVFQHEKGIPQYVIGHSAKLERIEGYLGELPGLFLNSNAYRGIGLNDCVSNSQETARRVREFLAS |
| A0A3M1DWF9 | 95-210 | None |
| A0A3Q2U669 | 34-126 | None |
| A0A445CDX5 | 1-97 | None |
| A0A6I8NWI1 | 95-183 | None |
| A0A812PRQ9 | 22-126 | None |
| A0A3Q1N9B0 | 46-134 | None |
| S7SUB6 | 2-82 | None |
| A0A6I9N4S9 | 17-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.