DPCstruct | MC25884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 285 ± 32 aa |
| Standard deviation of domain lengths | 31.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5LV85 | 133-404 | DITARKRAQAAQGRLRRRYLLTAAVLAIIAFFVSGYHLYHFSESIEFCGVQCHSVMQAEYRLHARSSHSHVTCAECHIGAGASWFVK… |
| A0A7X9F8F1 | 1-272 | MIDLNNPNHKKAFITFTIVTLIILLLSTYGSFEAYHLTESVPFCGTLCHKVMEPEYTAYQNSPHANISCVECHVGSGASWYVKSKLS… |
| A0A7C7QQ67 | 3-273 | None |
| A0A7V3QYH8 | 197-519 | None |
| A0A2V8R4F5 | 6-247 | None |
| A0A7C3B7B6 | 10-242 | None |
| A0A3N5L3Y0 | 8-323 | None |
| A0A419E826 | 9-262 | None |
| A0A5C1MF08 | 5-327 | None |
| A0A2N1VME5 | 230-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.