DPCstruct | MC25881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 129 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1YE22 | 532-655 | SAWVDLQETEPGQWKMRQRSSVKPYASSDADTQRIWWSDPGVHQNITFPVHPDPVSGMHCWHQMVRVERAGPEDRYGDIFVDTNRSY… |
| A0A3M0WFR5 | 4-146 | GSSKVKINRNGNTWSMRVEEGAVPREVKIEHNEQGLKWPYPGFNKDIKEVWWKATTGVWQNAVFPPNPDPLSGMQCWHKKVLLEKAG… |
| A0A0B8NBM9 | 122-245 | None |
| A0A7C2MCV2 | 40-163 | None |
| A0A7V9MGG3 | 251-375 | None |
| A0A7Z9SET3 | 1-128 | None |
| A0A1W1BVL6 | 500-631 | None |
| A0A7Y2BDS1 | 368-496 | None |
| A0A848VR59 | 178-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.