DPCstruct | MC2588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 208 ± 38 aa |
| Standard deviation of domain lengths | 37.97 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060VSX3 | 228-446 | DNFSYVIPKAVYDPQHLFRPGSASSDLHISYSITDYFCPLLVYHDTPWIPSLELWNGNEFVEQVSADFVMFEVNGMYNYQYLQSVED… |
| A0A7J8I4W9 | 1-196 | MELWREGKFQEIVEAEFVLLEVNGLFTYTYSLTAGTALCISQPQNWTTILENAGDKGPFAWDREVNYVSCHDPNSDAPLKWPKARYQ… |
| A0A2R5GCM5 | 843-1088 | None |
| A0A7J7JAY6 | 681-878 | None |
| A0A0L0SXC2 | 418-595 | None |
| A0A674IW93 | 214-461 | None |
| A0A834DBT2 | 32-226 | None |
| A0A821ZUD9 | 132-388 | None |
| A0A674C957 | 160-312 | None |
| A0A672L9D0 | 88-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.