DPCstruct | MC25876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 66 ± 13 aa |
| Standard deviation of domain lengths | 12.94 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A368EWS0 | 37-111 | EEPLCILDFYIHDSVQRRGNGHQLFDHMLKQESTSAAAVAIDRPSDAFLQFLSKFYGLKKPVWQSTNFVVFPEFF |
| A0A3R7AUR5 | 1-68 | MEVSTLQDLLRDPTKKHIVDTRESVAPHQLAYDRPSPKLFPFLRKHFKLDSYVPQSNRFVVYDAYFSA |
| A0A6I9YGS5 | 144-194 | None |
| A0A815P2V7 | 1-48 | None |
| A0A2P6NXA6 | 332-399 | None |
| V6T910 | 33-106 | None |
| A0A817CY30 | 113-189 | None |
| A0A653DH68 | 140-188 | None |
| A0A674HMY0 | 118-188 | None |
| A0C5Y7 | 99-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.