DPCstruct | MC25875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 218 ± 18 aa |
| Standard deviation of domain lengths | 18.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7A0U1 | 1-218 | MNDLALLNFMVRSAEGWLTKEQVVALKFAMHLGDLLTARGRLERTAGSNQLMFVLFECSVTLSWESVHPGIAYSCDQSTFYTSADSG… |
| A0A7S4SYZ5 | 138-322 | GAEVRTVRKDISAGDVVHFEGRFRPRSRVLDAVSYRMLQRWSDRGDGEHFAVKRHRNGKDHPVVGHDPSSSSSRPKSFCKFWLSNGS… |
| A0A1Y5INK6 | 90-289 | None |
| M4BWC1 | 1-231 | None |
| A0A7S3XC35 | 54-300 | None |
| A0A812JQE8 | 73-266 | None |
| A0A7J6R0B2 | 844-1050 | None |
| A0A7R9Y765 | 1-228 | None |
| A0A6A3IZ32 | 348-576 | None |
| A0A7J6LB39 | 73-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.