DPCstruct | MC25874
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 185 ± 32 aa |
| Standard deviation of domain lengths | 32.07 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4Y5Q8 | 17-155 | GRVFFMLNGQNEGIYLSWMHKESCLLELAQTAALHLAADSERVANGLKLFSIDGLPILTADELNTLRIAHVLLDGQLWVWPGIKVGY… |
| A0A0W8D2Q3 | 77-248 | PVKGFHVLCIQKRPEGDLGITAFKHGNAPSMRIQSKTEFTDLKTQLEKTLEIQGPKDEVARQYKQPYAFFTPEGTKLERLDEMVNQI… |
| A0A1W0A697 | 300-454 | None |
| D8LI73 | 10-230 | None |
| A0A7S2SRF8 | 17-214 | None |
| A0A397EFF2 | 3-152 | None |
| A0A225X1S1 | 234-459 | None |
| A0A0W8D4U3 | 103-277 | None |
| A0A1V9ZQ09 | 1-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.