DPCstruct | MC25873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0376 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R6YT70 | 21-109 | AYDPAKMTEFRARAQALFKEHKVRPFMSFLMPISQLPIFLGFFWGLQDIAKYIPGYAADGAFWFENLAAPDPTYALPVLSSALMVAS… |
| A0A835UWE5 | 1-76 | MKELFKKHGVTPFTPLKGALIQGPIFISFFFAISNMVEKVPSFKGGGAYWFTDLTTPDAMYIFPVLTSLSFLATVE |
| A0A1U8NUL8 | 4-89 | None |
| A0A5E6NMZ5 | 24-117 | None |
| A0A2J6M0I7 | 6-88 | None |
| A0A6S7MN16 | 62-161 | None |
| A0A803M512 | 201-285 | None |
| A0A1U8N316 | 23-103 | None |
| A0A6A2Y288 | 378-466 | None |
| A0A3S5EZ15 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.